PDB entry 1mk9

View 1mk9 on RCSB PDB site
Description: crystal structure of an integrin beta3-talin chimera
Class: structural protein
Keywords: FOCAL ADHESION, INTEGRIN BINDING, FERM DOMAIN, CYTOSKELETON NPXY MOTIF, PTB DOMAIN, structural protein
Deposited on 2002-08-28, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.242
AEROSPACI score: -1.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin beta3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05106 (4-15)
      • cloning artifact (3)
  • Chain 'B':
    Compound: Talin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mk9b1, d1mk9b2
  • Chain 'C':
    Compound: integrin beta3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05106 (4-15)
      • cloning artifact (1-3)
  • Chain 'D':
    Compound: Talin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mk9d1, d1mk9d2
  • Chain 'E':
    Compound: integrin beta3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05106 (4-15)
      • cloning artifact (2-3)
  • Chain 'F':
    Compound: Talin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mk9f1, d1mk9f2
  • Chain 'G':
    Compound: integrin beta3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05106 (4-15)
      • cloning artifact (2-3)
  • Chain 'H':
    Compound: Talin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mk9h1, d1mk9h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mk9B (B:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mk9B (B:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekmkglvprllg
    itkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqiaql
    iagyidi
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mk9D (D:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1mk9F (F:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mk9F (F:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidi
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mk9H (H:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mk9H (H:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkeknklvprllgi
    tkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqiaqli
    agyidiil