PDB entry 1mk7

View 1mk7 on RCSB PDB site
Description: crystal structure of an integrin beta3-talin chimera
Class: structural protein
Keywords: FOCAL ADHESION, INTEGRIN BINDING, FERM DOMAIN, CYTOSKELETON, NPXY MOTIF, PTB DOMAIN, structural protein
Deposited on 2002-08-28, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: -1.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin beta3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05106 (4-14)
      • cloning artifact (2-3)
  • Chain 'B':
    Compound: Talin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mk7b1, d1mk7b2
  • Chain 'C':
    Compound: integrin beta3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05106 (4-14)
      • cloning artifact (1-3)
  • Chain 'D':
    Compound: Talin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mk7d1, d1mk7d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mk7B (B:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mk7D (D:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mk7D (D:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekklvprllgit
    kecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqiaqlia
    gyidiil