PDB entry 1mk7

View 1mk7 on RCSB PDB site
Description: crystal structure of an integrin beta3-talin chimera
Deposited on 2002-08-28, released 2003-01-28
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-28, with a file datestamp of 2003-01-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: -1.62 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mk7B (B:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mk7D (D:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mk7D (D:)
    pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
    eyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekklvprllgit
    kecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqiaqlia
    gyidiil