PDB entry 1mk4

View 1mk4 on RCSB PDB site
Description: Structure of Protein of Unknown Function YqjY from Bacillus subtilis, Probable Acetyltransferase
Class: structural genomics, unknown function
Keywords: alpha-beta-alpha sandwich, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2002-08-28, released 2003-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.22
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yqjY
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YQJY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54562 (1-156)
      • expression tag (0)
    Domains in SCOPe 2.06: d1mk4a1, d1mk4a2
  • Chain 'B':
    Compound: Hypothetical protein yqjY
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YQJY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54562 (1-156)
      • expression tag (0)
    Domains in SCOPe 2.06: d1mk4b1, d1mk4b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mk4A (A:)
hmdirtitssdyemvtsvlnewwggrqlkeklprlffehfqdtsfitsehnsmtgfligf
qsqsdpetayihfsgvhpdfrkmqigkqlydvfietvkqrgctrvkcvtspvnkvsiayh
tklgfdiekgtktvngisvfanydgpgqdrvlfvkni

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mk4B (B:)
hmdirtitssdyemvtsvlnewwggrqlkeklprlffehfqdtsfitsehnsmtgfligf
qsqsdpetayihfsgvhpdfrkmqigkqlydvfietvkqrgctrvkcvtspvnkvsiayh
tklgfdiekgtktvngisvfanydgpgqdrvlfvkni