PDB entry 1mk3

View 1mk3 on RCSB PDB site
Description: solution structure of human bcl-w protein
Class: apoptosis
Keywords: Bcl-w protein, apoptotis, APOPTOSIS
Deposited on 2002-08-28, released 2003-06-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator Bcl-W
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92843 (0-169)
      • engineered (115)
      • expression tag (170-177)
    Domains in SCOPe 2.02: d1mk3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mk3A (A:)
    atpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtf
    sdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemevlvgq
    vqewmvayletrladwihssggwaeftalygdgaleearrlregnwasvrlehhhhhh