PDB entry 1mjx

View 1mjx on RCSB PDB site
Description: structure of inorganic pyrophosphatase mutant d65n
Class: hydrolase
Keywords: hydrolase, acid anhydride hydrolase, mutation
Deposited on 1997-02-08, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7A9 (0-174)
      • engineered (64)
    Domains in SCOPe 2.07: d1mjxa_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7A9 (0-174)
      • engineered (64)
    Domains in SCOPe 2.07: d1mjxb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mjxA (A:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlslngdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mjxB (B:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlslngdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk