PDB entry 1mju

View 1mju on RCSB PDB site
Description: 1.22 angstrom resolution crystal structure of the fab fragment of esterolytic antibody ms6-12
Deposited on 2002-08-28, released 2003-09-23
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: 0.123
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mjuH (H:)
    evqlqqpgaelvkpgasvklsckasgytftnywinwvkqrpgqglewigniypgssythy
    nekfknkatltvdtssstaymqlssltsddsavyycanklgwfpywgqgtlvtvsaaktt
    apsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjuH (H:)
    evqlqqpgaelvkpgasvklsckasgytftnywinwvkqrpgqglewigniypgssythy
    nekfknkatltvdtssstaymqlssltsddsavyycanklgwfpywgqgtlvtvsaaktt
    apsvyplapvcsvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtv
    tsstwpsqsitcnvahpasstkvdkkieprgp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mjuL (L:)
    divmtqaapsvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec