PDB entry 1mjq

View 1mjq on RCSB PDB site
Description: methionine repressor mutant (q44k) plus corepressor (s-adenosyl methionine) complexed to an altered met consensus operator sequence
Class: transcription/DNA
Keywords: transcription regulation, metj, methionine repressor, sheet-helix-helix, s-adenosyl methionine, DNA, complex (transcription regulation/DNA), transcription/DNA complex
Deposited on 1998-01-30, released 1999-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine repressor
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mjqa_
  • Chain 'B':
    Compound: methionine repressor
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mjqb_
  • Chain 'C':
    Compound: methionine repressor
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mjqc_
  • Chain 'D':
    Compound: methionine repressor
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mjqd_
  • Chain 'E':
    Compound: mutated met consensus operator duplex
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: mutated met consensus operator duplex
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: methionine repressor
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mjqg_
  • Chain 'H':
    Compound: methionine repressor
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mjqh_
  • Chain 'I':
    Compound: methionine repressor
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mjqi_
  • Chain 'J':
    Compound: methionine repressor
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mjqj_
  • Chain 'K':
    Compound: mutated met consensus operator duplex
    Species: synthetic, synthetic
  • Chain 'L':
    Compound: mutated met consensus operator duplex
    Species: synthetic, synthetic
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mjqA (A:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mjqB (B:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mjqC (C:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mjqD (D:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mjqG (G:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mjqH (H:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mjqI (I:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mjqJ (J:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.