PDB entry 1mjj

View 1mjj on RCSB PDB site
Description: high resolution crystal structure of the complex of the fab fragment of esterolytic antibody ms6-12 and a transition-state analog
Class: immune system
Keywords: catalytic antibody, ester hydrolysis, esterolytic, fab, immunoglobulin, immune system
Deposited on 2002-08-28, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin ms6-12
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJJ (0-End)
    Domains in SCOPe 2.07: d1mjja1, d1mjja2
  • Chain 'B':
    Compound: immunoglobulin ms6-12
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJJ (0-End)
    Domains in SCOPe 2.07: d1mjjb1, d1mjjb2
  • Chain 'H':
    Compound: immunoglobulin ms6-12
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJJ (0-End)
    Domains in SCOPe 2.07: d1mjjh1, d1mjjh2
  • Chain 'L':
    Compound: immunoglobulin ms6-12
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJJ (0-End)
    Domains in SCOPe 2.07: d1mjjl1, d1mjjl2
  • Heterogens: SO4, HAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mjjA (A:)
    divmtqaapsvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjjA (A:)
    divmtqaapsvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mjjB (B:)
    evqlqqpgaelvkpgasvklsckasgytftnywinwvkqrpgqglewigniypgssythy
    nekfknkatltvdtssstaymqlssltsddsavyycanklgwfpywgqgtlvtvsaaktt
    apsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjjB (B:)
    evqlqqpgaelvkpgasvklsckasgytftnywinwvkqrpgqglewigniypgssythy
    nekfknkatltvdtssstaymqlssltsddsavyycanklgwfpywgqgtlvtvsaaktt
    apsvyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
    vtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mjjH (H:)
    evqlqqpgaelvkpgasvklsckasgytftnywinwvkqrpgqglewigniypgssythy
    nekfknkatltvdtssstaymqlssltsddsavyycanklgwfpywgqgtlvtvsaaktt
    apsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjjH (H:)
    evqlqqpgaelvkpgasvklsckasgytftnywinwvkqrpgqglewigniypgssythy
    nekfknkatltvdtssstaymqlssltsddsavyycanklgwfpywgqgtlvtvsaaktt
    apsvyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
    vtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mjjL (L:)
    divmtqaapsvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjjL (L:)
    divmtqaapsvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr