PDB entry 1mji

View 1mji on RCSB PDB site
Description:
Deposited on 2002-08-28, released 2003-01-21
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-21, with a file datestamp of 2003-01-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mjia_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mjib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mjiA (A:)
    mpldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqel
    alitgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgl
    npnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpf
    rk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjiA (A:)
    ldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelal
    itgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnp
    nsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mjiB (B:)
    mpldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqel
    alitgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgl
    npnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpf
    rk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjiB (B:)
    dvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelali
    tgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnpn
    sfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk