PDB entry 1mjh

View 1mjh on RCSB PDB site
Description: structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics
Deposited on 1998-11-04, released 1998-12-23
The last revision prior to the SCOP 1.65 freeze date was dated 1999-05-20, with a file datestamp of 1999-05-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.21
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1mjha_
  • Chain 'B':
    Domains in SCOP 1.65: d1mjhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mjhA (A:)
    msvmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgva
    glnksveefenelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedeg
    vdiiimgshgktnlkeillgsvtenvikksnkpvlvvkrkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjhA (A:)
    vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikveefenelknklte
    eaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeill
    gsvtenvikksnkpvlvvkrkns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mjhB (B:)
    msvmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgva
    glnksveefenelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedeg
    vdiiimgshgktnlkeillgsvtenvikksnkpvlvvkrkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjhB (B:)
    vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereiksveefenelknklt
    eeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeil
    lgsvtenvikksnkpvlvvkrkns