PDB entry 1mjc

View 1mjc on RCSB PDB site
Description: crystal structure of cspa, the major cold shock protein of escherichia coli
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1994-03-18, released 1994-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 1994-06-22, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major cold-shock protein 7.4
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mjca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mjcA (A:)
    sgkmtgivkwfnadkgfgfitpddgskdvfvhfsaiqndgyksldegqkvsftiesgakg
    paagnvtsl