PDB entry 1mjc

View 1mjc on RCSB PDB site
Description: crystal structure of cspa, the major cold shock protein of escherichia coli
Deposited on 1994-03-18, released 1994-06-22
The last revision prior to the SCOP 1.59 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1mjc__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mjc_ (-)
  sgkmtgivkwfnadkgfgfitpddgskdvfvhfsaiqndgyksldegqkvsftiesgakg
  paagnvtsl