PDB entry 1mj7

View 1mj7 on RCSB PDB site
Description: Crystal Structure Of The Complex Of The Fab fragment of Esterolytic Antibody MS5-393 and A Transition-State Analog
Class: immune system
Keywords: catalytic antibody, ester hydrolysis, esterolytic, fab, immunoglobulin, tsa, immune system
Deposited on 2002-08-27, released 2003-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin ms5-393
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJ7
    Domains in SCOPe 2.05: d1mj7h1, d1mj7h2
  • Chain 'L':
    Compound: immunoglobulin ms5-393
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJ7 (0-End)
    Domains in SCOPe 2.05: d1mj7l1, d1mj7l2
  • Heterogens: HAL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mj7H (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsswinwvkqrpgqglewignvypgssstny
    nekfknkatltvdtssstaymqlssltsddsafyycvrkdyswfpywgqgtlvtvsaakt
    tapsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj7H (H:)
    lqqpgaelvkpgasvklscsswinwvkqrpgqglewignvypstnynekfknkatltvdt
    ssstaymqlssltsddsafyycvrkdfpywgqgtlvtvsaakttapsvyplapssvtlgc
    lvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtvtsstwpsqsitcnvahp
    asstkvdkkiepr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mj7L (L:)
    eivmtqaapsvpvtpgesvsiscrssksllhsngntylnwflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsetaftlrtsrveaedvgvyycmqhleypftfgsgtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj7L (L:)
    eivmtqaapsvpvtpgesvsiscrssksllhsngntylnwflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsetaftlrtsrveaedvgvyycmqhleypftfgsgtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne