PDB entry 1mj5

View 1mj5 on RCSB PDB site
Description: LINB (haloalkane dehalogenase) from sphingomonas paucimobilis UT26 at atomic resolution
Class: hydrolase
Keywords: LINB, hydrolase, Haloalkane dehalogenase, 1, 3, 4, 6-tetrachloro-1, 4-cyclohexadiene dehalogenase, gamma-Hexachlorocyclohexane degradation, alpha/beta-hydrolase, ultra high resolution
Deposited on 2002-08-27, released 2003-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.112
AEROSPACI score: 1.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase
    Species: SPHINGOMONAS PAUCIMOBILIS [TaxId:13689]
    Gene: LINB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51698 (Start-295)
      • expression tag (296-298)
    Domains in SCOPe 2.07: d1mj5a1, d1mj5a2
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mj5A (A:)
    mslgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrlia
    cdligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarr
    hrervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilr
    plseaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklf
    inaepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpahhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj5A (A:)
    slgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliac
    dligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrh
    rervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrp
    lseaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfi
    naepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpahhh