PDB entry 1mj3

View 1mj3 on RCSB PDB site
Description: Crystal Structure Analysis of rat enoyl-CoA hydratase in complex with hexadienoyl-CoA
Deposited on 2002-08-26, released 2002-09-24
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1mj3a_
  • Chain 'B':
    Domains in SCOP 1.63: d1mj3b_
  • Chain 'C':
    Domains in SCOP 1.63: d1mj3c_
  • Chain 'D':
    Domains in SCOP 1.63: d1mj3d_
  • Chain 'E':
    Domains in SCOP 1.63: d1mj3e_
  • Chain 'F':
    Domains in SCOP 1.63: d1mj3f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mj3A (A:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj3A (A:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysglshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mj3B (B:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj3B (B:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysglshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mj3C (C:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj3C (C:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysglshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mj3D (D:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj3D (D:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysglshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mj3E (E:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj3E (E:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysglshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1mj3F (F:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj3F (F:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysglshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh