PDB entry 1mj2

View 1mj2 on RCSB PDB site
Description: methionine repressor mutant (q44k) plus corepressor (s-adenosyl methionine) complexed to a consensus operator sequence
Class: transcription/DNA
Keywords: transcription regulation, metj, methionine repressor, sheet-helix-helix, s-adenosyl methionine, DNA, complex (transcription regulation/DNA), transcription/DNA complex
Deposited on 1998-01-27, released 1999-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (methionine repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mj2a_
  • Chain 'B':
    Compound: protein (methionine repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mj2b_
  • Chain 'C':
    Compound: protein (methionine repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mj2c_
  • Chain 'D':
    Compound: protein (methionine repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: METJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8U6 (0-103)
      • engineered (43)
    Domains in SCOPe 2.08: d1mj2d_
  • Chain 'F':
    Compound: DNA (5'-d(*tp*tp*ap*gp*ap*cp*gp*tp*cp*tp*ap*gp*ap*cp*gp*tp*cp*tp*a)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*tp*tp*ap*gp*ap*cp*gp*tp*cp*tp*ap*gp*ap*cp*gp*tp*cp*tp*a)-3')
  • Heterogens: CA, SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mj2A (A:)
    aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
    flhaftgqplpddadlrkersdeipeaakeimremginpetwey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mj2B (B:)
    aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
    flhaftgqplpddadlrkersdeipeaakeimremginpetwey
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mj2C (C:)
    aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
    flhaftgqplpddadlrkersdeipeaakeimremginpetwey
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mj2D (D:)
    aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
    flhaftgqplpddadlrkersdeipeaakeimremginpetwey
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.