PDB entry 1mj1

View 1mj1 on RCSB PDB site
Description: FITTING THE TERNARY COMPLEX OF EF-Tu/tRNA/GTP AND RIBOSOMAL PROTEINS INTO A 13 A CRYO-EM MAP OF THE COLI 70S RIBOSOME
Class: ribosome
Keywords: 70S RIBOSOME, LOW RESOLUTION MODEL TERNARY COMPLEX, EF-Tu, RIBOSOME
Deposited on 2002-08-26, released 2002-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: EM
Resolution: 13 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJ1 (0-404)
    Domains in SCOPe 2.06: d1mj1a_
  • Chain 'C':
    Compound: Phe-tRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'D':
    Compound: Phe-tRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'L':
    Compound: l11 ribosomal protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJ1
    Domains in SCOPe 2.06: d1mj1l_
  • Chain 'O':
    Compound: S12 ribosomal protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mj1o_
  • Chain 'P':
    Compound: S13 ribosomal protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJ1 (Start-125)
    Domains in SCOPe 2.06: d1mj1p_
  • Chain 'Q':
    Compound: sarcin-ricin loop of 23SrRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'R':
    Compound: helix 69 of 23S rRNA
    Species: Escherichia coli [TaxId:562]

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mj1A (A:)
    akgefirtkrhvnvgtighvdhgkttltaaltyvaaaenrnvevkdygdidkareerarg
    itintahveyetakrhyshvdcrghadyiknmitgaaqmdgailvvsaadgrmrqtrehi
    llarqvgvryivvfmnkvdmvddrelldlvemevrdllnqyefrgdevrvirgsallale
    emhknrktkrgenewvdkiwelldaideyirtrvrdvdkrflmrvedvftitgrgtvatg
    riergkvkvgdeveivglaretrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakrgsitrhtkfeasvyilkkeeggrhtgfftgyrrqfyfrttdvtgvvrlrqgve
    mvmrgdnvtftvelikrvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mj1L (L:)
    makkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitv
    yedksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnans
    leaamkiiegtaksmgievvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj1L (L:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1mj1O (O:)
    mvalptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrl
    tsgyevtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrsky
    gtkkpkeaaktaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj1O (O:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1mj1P (P:)
    mariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyv
    entwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagk
    kkaprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj1P (P:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.