PDB entry 1miz

View 1miz on RCSB PDB site
Description: Crystal structure of an integrin beta3-talin chimera
Class: structural protein
Keywords: focal adhesion, integrin binding, cytoskeleton, npxy motif, ptb domain, structural protein
Deposited on 2002-08-23, released 2003-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: -1.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin beta3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05106 (4-8)
      • cloning artifact (0-3)
  • Chain 'B':
    Compound: Talin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mizb1, d1mizb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mizB (B:)
sdqnvdsrdpvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgf
lelkdflpkeyikqkgerkifmahkncgnmseieakvryvklarslktygvsfflvkekm
kgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyys
vqttegeqiaqliagyidiil