PDB entry 1mix

View 1mix on RCSB PDB site
Description: Crystal structure of a FERM domain of Talin
Class: structural protein
Keywords: focal adhesion, integrin binding, ferm domain, cytoskeleton, structural protein
Deposited on 2002-08-23, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.199
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Talin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mixa1, d1mixa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mixA (A:)
    mkffysdqnvdsrdpvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqk
    hkpgflelkdflpkeyikqkgerkifmahkncgnmseieakvryvklarslktygvsffl
    vkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyq
    dgyysvqttegeqiaqliagyidiil