PDB entry 1mix

View 1mix on RCSB PDB site
Description: Crystal structure of a FERM domain of Talin
Deposited on 2002-08-23, released 2003-01-28
The last revision prior to the SCOP 1.65 freeze date was dated 2003-01-28, with a file datestamp of 2003-01-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mixA (A:)
    mkffysdqnvdsrdpvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqk
    hkpgflelkdflpkeyikqkgerkifmahkncgnmseieakvryvklarslktygvsffl
    vkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyq
    dgyysvqttegeqiaqliagyidiil