PDB entry 1mit

View 1mit on RCSB PDB site
Description: recombinant cucurbita maxima trypsin inhibitor v (rcmti-v) (nmr, minimized average structure)
Class: serine protease inhibitor (rcmti-v)
Keywords: serine protease inhibitor (rcmti-v)
Deposited on 1995-10-26, released 1996-04-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: trypsin inhibitor v
  Species: Cucurbita maxima [TaxId:3661]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19873 (1-68)
  Domains in SCOPe 2.03: d1mita_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mitA (A:)
  gsscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtkdfrcnrvriwvnkrg
  lvvspprig