PDB entry 1mit

View 1mit on RCSB PDB site
Description: recombinant cucurbita maxima trypsin inhibitor v (rcmti-v) (nmr, minimized average structure)
Deposited on 1995-10-26, released 1996-04-03
The last revision prior to the SCOP 1.59 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1mit__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mit_ (-)
    gsscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtkdfrcnrvriwvnkrg
    lvvspprig