PDB entry 1mio

View 1mio on RCSB PDB site
Description: x-ray crystal structure of the nitrogenase molybdenum-iron protein from clostridium pasteurianum at 3.0 angstroms resolution
Class: molybdenum-iron protein
Keywords: molybdenum-iron protein
Deposited on 1993-03-24, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.18
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum iron protein (alpha chain)
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mioa_
  • Chain 'B':
    Compound: nitrogenase molybdenum iron protein (beta chain)
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1miob_
  • Chain 'C':
    Compound: nitrogenase molybdenum iron protein (alpha chain)
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mioc_
  • Chain 'D':
    Compound: nitrogenase molybdenum iron protein (beta chain)
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1miod_
  • Heterogens: CA, HCA, CFM, CLP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mioA (A:)
    senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
    vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
    klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
    qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
    gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
    cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
    slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
    vplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
    hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasseskvvvggea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mioA (A:)
    senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
    vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
    klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
    qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
    gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
    cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
    slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
    vplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
    hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasses
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mioB (B:)
    mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf
    kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis
    qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg
    padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls
    lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli
    dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae
    agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy
    ynpkvgykgairlveeitnvildkierecteedfevvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mioB (B:)
    ldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhfk
    epamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyisq
    medagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvgp
    admreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltlsl
    gsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqlid
    lmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlaea
    giegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghyy
    npkvgykgairlveeitnvildkierecteedfevvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mioC (C:)
    senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
    vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
    klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
    qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
    gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
    cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
    slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
    vplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
    hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasseskvvvggea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mioC (C:)
    senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
    vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
    klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
    qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
    gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
    cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
    slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
    vplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
    hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasses
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mioD (D:)
    mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf
    kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis
    qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg
    padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls
    lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli
    dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae
    agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy
    ynpkvgykgairlveeitnvildkierecteedfevvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mioD (D:)
    ldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhfk
    epamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyisq
    medagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvgp
    admreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltlsl
    gsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqlid
    lmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlaea
    giegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghyy
    npkvgykgairlveeitnvildkierecteedfevvr