PDB entry 1mio

View 1mio on RCSB PDB site
Description:
Deposited on 1993-03-24, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3 Å
R-factor: 0.18
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1mioa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1miob_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1mioc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1miod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mioA (A:)
    senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
    vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
    klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
    qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
    gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
    cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
    slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
    vplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
    hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasses
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mioA (A:)
    senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
    vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
    klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
    qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
    gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
    cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
    slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
    vplsayggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
    hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasses
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mioB (B:)
    ldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhfk
    epamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyisq
    medagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvgp
    admreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltlsl
    gsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqlid
    lmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlaea
    giegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghyy
    npkvgykgairlveeitnvildkierecteedfevvr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mioC (C:)
    senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
    vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
    klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
    qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
    gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
    cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
    slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
    vplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
    hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasses
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mioD (D:)
    ldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhfk
    epamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyisq
    medagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvgp
    admreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltlsl
    gsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqlid
    lmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlaea
    giegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghyy
    npkvgykgairlveeitnvildkierecteedfevvr