PDB entry 1mim

View 1mim on RCSB PDB site
Description: igg fab fragment (cd25-binding)
Class: immunoglobulin
Keywords: immunoglobulin, c region
Deposited on 1995-12-04, released 1997-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimeric sdz chi621
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAG00910 (1-213)
      • insertion (2)
      • conflict (16)
      • conflict (28)
      • conflict (31)
      • conflict (47)
      • conflict (53)
      • conflict (56)
      • conflict (58)
      • conflict (60)
      • conflict (62-63)
      • conflict (74)
      • conflict (85)
      • conflict (95-96)
      • conflict (98-99)
      • conflict (101)
      • conflict (110)
      • conflict (114)
      • conflict (128)
      • conflict (130)
      • conflict (134-135)
      • conflict (189-190)
      • conflict (196)
      • conflict (200)
      • conflict (211)
    Domains in SCOPe 2.03: d1mimh1, d1mimh2
  • Chain 'L':
    Compound: chimeric sdz chi621
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01834 (1-209)
      • conflict (3)
      • conflict (9-10)
      • conflict (12)
      • conflict (17-18)
      • conflict (20-21)
      • conflict (23)
      • conflict (27-28)
      • conflict (31-32)
      • conflict (40-41)
      • conflict (43-45)
      • conflict (49)
      • conflict (51-52)
      • conflict (54)
      • conflict (56)
      • conflict (68-70)
      • conflict (76)
      • conflict (78)
      • conflict (81)
      • conflict (83)
      • conflict (87-88)
      • conflict (90-92)
      • conflict (100)
    Domains in SCOPe 2.03: d1miml1, d1miml2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mimH (H:)
    qlqqsgtvlarpgasvkmsckasgysftrywmhwikqrpgqglewigaiypgnsdtsynq
    kfegkakltavtsastaymelsslthedsavyycsrdygyyfdfwgqgttltvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mimL (L:)
    qivstqspaimsaspgekvtmtcsasssrsymqwyqqkpgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyychqrssytfgggtkleikrtvaapsvfifppsde
    qlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk
    adyekhkvyacevthqglsspvtksfnrge