PDB entry 1mim

View 1mim on RCSB PDB site
Description: igg fab fragment (cd25-binding)
Deposited on 1995-12-04, released 1997-05-15
The last revision prior to the SCOP 1.71 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mimH (H:)
    qlqqsgtvlarpgasvkmsckasgysftrywmhwikqrpgqglewigaiypgnsdtsynq
    kfegkakltavtsastaymelsslthedsavyycsrdygyyfdfwgqgttltvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mimL (L:)
    qivstqspaimsaspgekvtmtcsasssrsymqwyqqkpgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyychqrssytfgggtkleikrtvaapsvfifppsde
    qlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk
    adyekhkvyacevthqglsspvtksfnrge