PDB entry 1mij

View 1mij on RCSB PDB site
Description: Crystal Structure of the Homeo-prospero Domain of D. melanogaster Prospero
Class: transcription
Keywords: homeodomain, DNA-binding domain, prospero domain, 4-helix bundle, TRANSCRIPTION
Deposited on 2002-08-23, released 2002-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.216
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein prospero
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: PROS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29617 (0-151)
      • modified residue (6)
      • modified residue (14)
      • modified residue (28)
      • modified residue (58)
      • modified residue (140)
    Domains in SCOPe 2.06: d1mija_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mijA (A:)
    sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
    kyarqavtegiktpddlliagdselyrvlnlhynrnnhievpqnfrfvvestlreffrai
    qggkdteqswkksiykiisrmddpvpeyfksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mijA (A:)
    sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
    kyarqavteselyrvlnlhynrnnhievpqnfrfvvestlreffraiqggkdteqswkks
    iykiisrmddpvpeyfksp