PDB entry 1mij

View 1mij on RCSB PDB site
Description: Crystal Structure of the Homeo-prospero Domain of D. melanogaster Prospero
Deposited on 2002-08-23, released 2002-12-04
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.216
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1mija_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mijA (A:)
    sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
    kyarqavtegiktpddlliagdselyrvlnlhynrnnhievpqnfrfvvestlreffrai
    qggkdteqswkksiykiisrmddpvpeyfksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mijA (A:)
    sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
    kyarqavteselyrvlnlhynrnnhievpqnfrfvvestlreffraiqggkdteqswkks
    iykiisrmddpvpeyfksp