PDB entry 1mie

View 1mie on RCSB PDB site
Description: Crystal Structure Of The Fab Fragment of Esterolytic Antibody MS5-393
Deposited on 2002-08-23, released 2003-09-23
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.219
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mieH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsswinwvkqrpgqglewignvypgssstny
    nekfknkatltvdtssstaymqlssltsddsafyycvrkdyswfpywgqgtlvtvsaakt
    tapsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mieH (H:)
    qqpgaelvkpgasvklscwinwvkqrpgqglewignvypgssstnynekfknkatltvdt
    ssstaymqlssltsddsafyycvrpywgqgtlvtvsaakttapsvyplapvssvtlgclv
    kgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtvtsstwpsqsitcnvahpas
    stkvdkkiepr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mieL (L:)
    eivmtqaapsvpvtpgesvsiscrssksllhsngntylnwflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsetaftlrtsrveaedvgvyycmqhleypftfgsgtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mieL (L:)
    eivmtqaapsvpvtpgesvsiscrssksllhsngntylnwflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsetaftlrtsrveaedvgvyycmqhleypftfgsgtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne