PDB entry 1mi8

View 1mi8 on RCSB PDB site
Description: 2.0 Angstrom crystal structure of a DnaB intein from Synechocystis sp. PCC 6803
Class: hydrolase
Keywords: all beta-strands, Hydrolase
Deposited on 2002-08-22, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DnaB intein
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55418 (117-157)
      • engineered (2)
      • engineered (51)
      • engineered (120)
      • engineered (155)
    Domains in SCOPe 2.07: d1mi8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mi8A (A:)
    sgaisgdslislastgkrvsikdlldekdfeiwaineqtmklesakvsrvfmtgkklvyi
    lktrlgrtikatanhrfltidgwkrldelslkehialprklessslqlspeieklsqsdi
    swdsivsitetgveevfdltvpgphnfvandiivhasi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi8A (A:)
    sgaisgdslislastgkrvsikdlldekdfeiwaineqtmklesakvsrvfmtgkklvyi
    lktrlgrtikatanhrfltidgwkrldelslkehialprksdiswdsivsitetgveevf
    dltvpgphnfvandiivhasi