PDB entry 1mi6

View 1mi6 on RCSB PDB site
Description: Docking of the modified RF2 X-ray structure into the Low Resolution Cryo-EM map of RF2 E.coli 70S Ribosome
Class: translation, ribosome
Keywords: RF2,Release Complex, Conformational Changes, TRANSLATION, RIBOSOME
Deposited on 2002-08-22, released 2003-01-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: EM
Resolution: 10.9 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide chain release factor RF-2
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07012 (Start-364)
      • conflict (245)
      • conflict (297)
    Domains in SCOPe 2.04: d1mi6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mi6A (A:)
    mfeinpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgker
    ssleavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfs
    geydsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvt
    ikisgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlr
    idvyrasgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyevem
    qkknaekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieas
    lkagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi6A (A:)
    inpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgkerssl
    eavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfsgey
    dsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvtiki
    sgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlridv
    yrasgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyevemqkk
    naekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieaslka
    gl