PDB entry 1mi6

View 1mi6 on RCSB PDB site
Description: docking of the modified rf2 x-ray structure into the low resolution cryo-em map of rf2 e.coli 70s ribosome
Deposited on 2002-08-22, released 2003-01-14
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-14, with a file datestamp of 2003-01-14.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1mi6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mi6A (A:)
    mfeinpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgker
    ssleavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfs
    geydsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvt
    ikisgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlr
    idvyrasgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyevem
    qkknaekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieas
    lkagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi6A (A:)
    inpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgkerssl
    eavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfsgey
    dsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvtiki
    sgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlridv
    yrasgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyevemqkk
    naekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieaslka
    gl