PDB entry 1mi4

View 1mi4 on RCSB PDB site
Description: Glyphosate insensitive G96A mutant EPSP synthase liganded with shikimate-3-phosphate
Class: transferase
Keywords: inside-out alpha-beta barrel
Deposited on 2002-08-21, released 2002-12-18
The last revision prior to the SCOP 1.73 freeze date was dated 2002-12-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.157
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-enolpyruvylshikimate-3-phosphate synthase
    Species: Escherichia coli
    Gene: aroA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6D3 (0-426)
      • engineered (95)
    Domains in SCOP 1.73: d1mi4a_
  • Heterogens: S3P, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mi4A (A:)
    mesltlqpiarvdgtinlpgsksvsnralllaalahgktvltnlldsddvrhmlnaltal
    gvsytlsadrtrceiignggplhaegalelflgnaatamrplaaalclgsndivltgepr
    mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
    plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
    gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
    lnaidmdmnhipdaamtiataalfakgtttlrniynwrvketdrlfamatelrkvgaeve
    eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
    arisqaa