PDB entry 1mi3

View 1mi3 on RCSB PDB site
Description: 1.8 Angstrom structure of xylose reductase from Candida tenuis in complex with NAD
Class: oxidoreductase
Keywords: aldo-keto reductase, beta-alpha barrel, dimer, OXIDOREDUCTASE
Deposited on 2002-08-21, released 2003-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mi3a_
  • Chain 'B':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mi3b_
  • Chain 'C':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mi3c_
  • Chain 'D':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mi3d_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mi3A (A:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi3A (A:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mi3B (B:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi3B (B:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mi3C (C:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi3C (C:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mi3D (D:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi3D (D:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv