PDB entry 1mi2

View 1mi2 on RCSB PDB site
Description: solution structure of murine macrophage inflammatory protein-2, nmr, 20 structures
Class: cytokine
Keywords: mip-2, chemokine, nmr, cytokine
Deposited on 1997-10-24, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: macrophage inflammatory protein-2
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10889 (0-72)
  Domains in SCOPe 2.07: d1mi2a_
• Chain 'B':
  Compound: macrophage inflammatory protein-2
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10889 (0-72)
  Domains in SCOPe 2.07: d1mi2b_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mi2A (A:)
  avvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvq
  kiiqkilnkgkan
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mi2B (B:)
  avvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvq
  kiiqkilnkgkan