PDB entry 1mi0

View 1mi0 on RCSB PDB site
Description: Crystal Structure of the redesigned protein G variant NuG2
Class: immune system
Keywords: alpha-beta protein, redesigned beta-hairpin, IMMUNE SYSTEM
Deposited on 2002-08-21, released 2002-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.26
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: immunoglobulin-binding protein G
  Species: Finegoldia magna [TaxId:334413]
  Database cross-references and differences (RAF-indexed):
  • PIR A45063 (9-End)
    • expression tag (4-7)
    • see remark 999 (14-24)
    • engineered (54)
    • expression tag (7-8)
    • see remark 999 (15-20)
    • see remark 999 (22-25)
    • engineered (55)
  Domains in SCOPe 2.08: d1mi0a1, d1mi0a2
• Chain 'B':
  Compound: immunoglobulin-binding protein G
  Species: Finegoldia magna [TaxId:334413]
  Database cross-references and differences (RAF-indexed):
  • PIR A45063 (8-64)
    • expression tag (3-6)
    • see remark 999 (13-23)
    • engineered (53)
    • expression tag (6-7)
    • see remark 999 (14-19)
    • see remark 999 (21-24)
    • engineered (54)
  Domains in SCOPe 2.08: d1mi0b1, d1mi0b2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1mi0A (A:)
  mhhhhhhamdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatkt
  ftvte
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1mi0A (A:)
  hhhamdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatktftvt
  e
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1mi0B (B:)
  mhhhhhhamdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatkt
  ftvte
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1mi0B (B:)
  hhhhamdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatktftv
  te