PDB entry 1mhy

View 1mhy on RCSB PDB site
Description:
Deposited on 1996-10-21, released 1997-05-15
The last revision prior to the SCOP 1.71 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.137
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mhyb_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mhyd_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mhyg_

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mhyB (B:)
    msqpqssqvtkrgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaq
    pnpdwiaggldwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseea
    rytqrflaayssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirq
    tavfaaldkvdnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqg
    vqdwneilwaghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaidd
    lfvyclandsefgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsea
    lqrvfgdwkidyadkigfrvdvdqkvdavlagykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhyB (B:)
    krgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaqpnpdwiaggl
    dwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytqrflaay
    ssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavfaaldkv
    dnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdwneilwa
    ghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvyclands
    efgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsealqrvfgdwki
    dyadkigfrvdvdqkvdavlagy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mhyD (D:)
    maislatkaatnrapvgvepqevhkwlqsfnwdfkenrtkyptkyhmanetkeqfkviak
    eyarmeaakderqfgtlldgltrlgagnkvhprwgetmkvisnflevgeynaiaasamlw
    dsataaeqkngylaqvldeirhthqcafinhyyskhyhdpaghndarrtraigplwkgmk
    rvfadgfisgdavecsvnlqlvgeacftnplivavtewasangdeitptvflsvetdelr
    hmangyqtvvsiandpasakflntdlnnafwtqqkyftpvlgylfeygskfkvepwvktw
    nrwvsedwggiwigrlgkygvesprslrdakrdaywahhdlalaayamwplgfarlalpd
    eedqawfeanypgwadhygkifnewkklgyedpksgfipyqwllanghdvyidrvsqvpf
    ipslakgtgslrvhefngkkhsltddwgerqwlieperyechnvfeqyegrelseviaeg
    hgvrsdgktliaqphtrgdnlwtledikragcvfpdplakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhyD (D:)
    nrapvgvepqevhkwlqsfnwdfkenrtkyptkyhmanetkeqfkviakeyarmeaakde
    rqfgtlldgltrlgagnkvhprwgetmkvisnflevgeynaiaasamlwdsataaeqkng
    ylaqvldeirhthqcafinhyyskhyhdpaghndarrtraigplwkgmkrvfadgfisgd
    avecsvnlqlvgeacftnplivavtewasangdeitptvflsvetdelrhmangyqtvvs
    iandpasakflntdlnnafwtqqkyftpvlgylfeygskfkvepwvktwnrwvsedwggi
    wigrlgkygvesprslrdakrdaywahhdlalaayamwplgfarlalpdeedqawfeany
    pgwadhygkifnewkklgyedpksgfipyqwllanghdvyidrvsqvpfipslakgtgsl
    rvhefngkkhsltddwgerqwlieperyechnvfeqyegrelseviaeghgvrsdgktli
    aqphtrgdnlwtledikragcvfpdplakf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1mhyG (G:)
    makrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierk
    ieeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlyk
    ppvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhyG (G:)
    akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki
    eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlykp
    pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq