PDB entry 1mhx

View 1mhx on RCSB PDB site
Description: Crystal Structures of the redesigned protein G variant NuG1
Class: immune system
Keywords: alpha-beta protein, redesigned first beta-hairpin
Deposited on 2002-08-21, released 2002-09-18
The last revision prior to the SCOP 1.73 freeze date was dated 2002-12-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin-binding protein G
    Species: Peptostreptococcus magnus
    Database cross-references and differences (RAF-indexed):
    • PIR A45063 (8-64)
      • his tag (0-7)
      • see remark 999 (14-24)
      • engineered (57)
    Domains in SCOP 1.73: d1mhxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhxA (A:)
    mhhhhhhamdtyklfivigdrvvvvtteavdaataekvfkqyandngvdgewtyddaakt
    ftvte