PDB entry 1mhx

View 1mhx on RCSB PDB site
Description: crystal structures of the redesigned protein g variant nug1
Deposited on 2002-08-21, released 2002-09-18
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1mhxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhxA (A:)
    mhhhhhhamdtyklfivigdrvvvvtteavdaataekvfkqyandngvdgewtyddaakt
    ftvte