PDB entry 1mht

View 1mht on RCSB PDB site
Description: covalent ternary structure of hhai methyltransferase, dna and s- adenosyl-l-homocysteine
Deposited on 1994-12-08, released 1995-06-03
The last revision prior to the SCOP 1.59 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.174
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1mhta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhtA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy