PDB entry 1mho

View 1mho on RCSB PDB site
Description: the 2.0 a structure of holo s100b from bovine brain
Class: calcium-binding
Keywords: calcium-binding, metal-binding
Deposited on 1997-09-11, released 1998-11-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-100 protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mhoa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhoA (A:)
    selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dsdgdgecdfqefmafvamittacheff