PDB entry 1mho

View 1mho on RCSB PDB site
Description: the 2.0 a structure of holo s100b from bovine brain
Deposited on 1997-09-11, released 1998-11-18
The last revision prior to the SCOP 1.61 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1mho__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mho_ (-)
  selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
  dsdgdgecdfqefmafvamittacheff