PDB entry 1mhn

View 1mhn on RCSB PDB site
Description: High resolution crystal structure of the SMN Tudor domain
Class: RNA binding protein
Keywords: SMN, SMA, spinal muscular atrophy
Deposited on 2002-08-20, released 2003-03-25
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.147
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Survival motor neuron protein
    Species: HOMO SAPIENS
    Gene: SMN1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mhna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhnA (A:)
    lqqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdllspice