PDB entry 1mhn

View 1mhn on RCSB PDB site
Description: High resolution crystal structure of the SMN Tudor domain
Class: RNA binding protein
Keywords: SMN, SMA, spinal muscular atrophy, RNA BINDING PROTEIN
Deposited on 2002-08-20, released 2003-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.147
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Survival motor neuron protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SMN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mhna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mhnA (A:)
lqqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdllspice