PDB entry 1mhl

View 1mhl on RCSB PDB site
Description: crystal structure of human myeloperoxidase isoform c crystallized in space group p2(1) at ph 5.5 and 20 deg c
Class: myeloperoxidase
Keywords: myeloperoxidase
Deposited on 1995-06-09, released 1996-01-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myeloperoxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mhl.1
  • Chain 'B':
    Compound: myeloperoxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mhl.2
  • Chain 'C':
    Compound: myeloperoxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mhl.1
  • Chain 'D':
    Compound: myeloperoxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mhl.2
  • Heterogens: NAG, CA, CL, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mhlA (A:)
    vtcpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpv
    alaravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhlA (A:)
    cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
    aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mhlB (B:)
    vtcpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpv
    alaravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhlB (B:)
    cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
    aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhlC (C:)
    vncetscvqqppcfplkippndpriknqadcipffrscpacpgsnitirnqinaltsfvd
    asmvygseeplarnlrnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripc
    flagdtrssempeltsmhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiit
    yrdylplvlgptamrkylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqp
    mepnprvplsrvffaswrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmr
    igldlpalnmqrsrdhglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpn
    nidiwmggvseplkrkgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqis
    lpriicdntgittvsknnifmsnsyprdfvncstlpalnlaswrea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhlD (D:)
    vncetscvqqppcfplkippndpriknqadcipffrscpacpgsnitirnqinaltsfvd
    asmvygseeplarnlrnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripc
    flagdtrssempeltsmhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiit
    yrdylplvlgptamrkylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqp
    mepnprvplsrvffaswrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmr
    igldlpalnmqrsrdhglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpn
    nidiwmggvseplkrkgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqis
    lpriicdntgittvsknnifmsnsyprdfvncstlpalnlaswrea