PDB entry 1mhh

View 1mhh on RCSB PDB site
Description: Antibody-antigen complex
Class: immune system
Keywords: Antibody-antigen complex, B cell superantigen, Immunoglobulin binding protein, IMMUNE SYSTEM
Deposited on 2002-08-20, released 2003-01-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1MHH (0-219)
    Domains in SCOPe 2.05: d1mhha1, d1mhha2
  • Chain 'B':
    Compound: Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1MHH (0-216)
    Domains in SCOPe 2.05: d1mhhb1, d1mhhb2
  • Chain 'C':
    Compound: Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1MHH (0-219)
    Domains in SCOPe 2.05: d1mhhc1, d1mhhc2
  • Chain 'D':
    Compound: Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1MHH (0-216)
    Domains in SCOPe 2.05: d1mhhd1, d1mhhd2
  • Chain 'E':
    Compound: protein L domain C
    Species: Finegoldia magna [TaxId:334413]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1MHH
    Domains in SCOPe 2.05: d1mhhe_
  • Chain 'F':
    Compound: protein L domain C
    Species: Finegoldia magna [TaxId:334413]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1MHH (0-End)
    Domains in SCOPe 2.05: d1mhhf_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhhA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnex
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mhhB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhhB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhhC (C:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnex
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mhhD (D:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhhD (D:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhhE (E:)
    evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngewtadledggnhmnikf
    agk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1mhhF (F:)
    evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngewtadledggnhmnikf
    agk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhhF (F:)
    evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngewtadledggnhmnikf
    ag