PDB entry 1mhc

View 1mhc on RCSB PDB site
Description: model of MHC class I h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution
Class: histocompatibility antigen/peptide
Keywords: HISTOCOMPATIBILITY ANTIGEN/PEPTIDE, HISTOCOMPATIBILITY ANTIGEN-PEPTIDE complex
Deposited on 1995-08-23, released 1996-01-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen h2-m3
    Species: Mus musculus [TaxId:10090]
    Gene: H2-M3 B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mhca1, d1mhca2
  • Chain 'B':
    Compound: MHC class I antigen h2-m3
    Species: Mus musculus [TaxId:10090]
    Gene: H2-M3 B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mhcb_
  • Chain 'C':
    Compound: nonapeptide from rat nadh dehydrogenase
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: MHC class I antigen h2-m3
    Species: Mus musculus [TaxId:10090]
    Gene: H2-M3 B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mhcd1, d1mhcd2
  • Chain 'E':
    Compound: MHC class I antigen h2-m3
    Species: Mus musculus [TaxId:10090]
    Gene: H2-M3 B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mhce_
  • Chain 'F':
    Compound: nonapeptide from rat nadh dehydrogenase
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mhcA (A:)
    gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw
    kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg
    sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq
    radppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgt
    fqkwaavvvpsgeeqrytcyvhheglteplalkwrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhcA (A:)
    gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw
    kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg
    sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq
    radppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgt
    fqkwaavvvpsgeeqrytcyvhheglteplalkwrs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhcB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mhcD (D:)
    gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw
    kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg
    sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq
    radppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgt
    fqkwaavvvpsgeeqrytcyvhheglteplalkwrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhcD (D:)
    gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw
    kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg
    sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq
    radppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgt
    fqkwaavvvpsgeeqrytcyvhheglteplalkwrs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhcE (E:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'F':
    No sequence available.