PDB entry 1mhc

View 1mhc on RCSB PDB site
Description:
Deposited on 1995-08-23, released 1996-01-29
The last revision prior to the SCOP 1.57 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1mhca1, d1mhca2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1mhcb1
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1mhcd1, d1mhcd2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1mhce1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhcA (A:)
    gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw
    kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg
    sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq
    radppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgt
    fqkwaavvvpsgeeqrytcyvhheglteplalkwrs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhcB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhcD (D:)
    gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw
    kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg
    sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq
    radppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgt
    fqkwaavvvpsgeeqrytcyvhheglteplalkwrs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhcE (E:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm