PDB entry 1mh8

View 1mh8 on RCSB PDB site
Description: Crystal Structure of a Phopholipase A2 Monomer with Isoleucine at Second Position
Class: hydrolase
Keywords: phospholipase, enzyme, phospholipids, hydrolase
Deposited on 2002-08-19, released 2003-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mh8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mh8A (A:)
    niyqfknmiectvparswwdfadygcycggggsgtptddldrccqvhdncynqaqeitgc
    rpkwktytyqctqgtltckgrnnacaattcdcdrlaaicfagapyndtnynidlkarcq